SCOPe 2.01: Domain d1ne3a_: 1ne3 A:

Lineage for d1ne3a_ (1ne3 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S28e [101765] (2 species)
   incomplete OB-fold lacking the last strand

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [101767] (1 PDB entry)

8. Domain d1ne3a_: 1ne3 A: [91828]
   structural genomics

Details for d1ne3a_

PDB Entry: 1ne3

PDB Description: solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744

PDB Compounds: (A:) 30S ribosomal protein S28E

SCOPe Domain Sequences for d1ne3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ne3a_ b.40.4.5 (A:) Ribosomal protein S28e {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtir
eakeirtp

Timeline for d1ne3a_:

• d1ne3a_ first appeared in SCOP 1.67
  
• d1ne3a_ appears in SCOP 1.75
  
• d1ne3a_ appears in SCOPe 2.02
  
• d1ne3a_ appears in the current release, SCOPe 2.08