Lineage for d1nddb_ (1ndd B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717136Protein Nedd8 [54244] (1 species)
  7. 717137Species Human (Homo sapiens) [TaxId:9606] [54245] (6 PDB entries)
  8. 717139Domain d1nddb_: 1ndd B: [37600]

Details for d1nddb_

PDB Entry: 1ndd (more details), 1.6 Å

PDB Description: structure of nedd8
PDB Compounds: (B:) protein (ubiquitin-like protein nedd8)

SCOP Domain Sequences for d1nddb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nddb_ d.15.1.1 (B:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOP Domain Coordinates for d1nddb_:

Click to download the PDB-style file with coordinates for d1nddb_.
(The format of our PDB-style files is described here.)

Timeline for d1nddb_: