Lineage for d1na7a_ (1na7 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673628Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1673629Species Human (Homo sapiens) [TaxId:9606] [75559] (41 PDB entries)
  8. 1673665Domain d1na7a_: 1na7 A: [91752]

Details for d1na7a_

PDB Entry: 1na7 (more details), 2.4 Å

PDB Description: crystal structure of the catalytic subunit of human protein kinase ck2
PDB Compounds: (A:) casein kinase II, alpha chain

SCOPe Domain Sequences for d1na7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na7a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpreywdyashvvewgnqddyqlvrklgrgkysevfeainitnne
kvvvkilkpvkknkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytvvk

SCOPe Domain Coordinates for d1na7a_:

Click to download the PDB-style file with coordinates for d1na7a_.
(The format of our PDB-style files is described here.)

Timeline for d1na7a_: