Lineage for d1n8yc2 (1n8y C:323-488)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851823Protein Protooncoprotein Her2 extracellular domain [82328] (2 species)
  7. 2851831Species Norway rat (Rattus norvegicus) [TaxId:10116] [82330] (1 PDB entry)
  8. 2851833Domain d1n8yc2: 1n8y C:323-488 [80315]
    Other proteins in same PDB: d1n8yc3, d1n8yc4
    complexed with nag

Details for d1n8yc2

PDB Entry: 1n8y (more details), 2.4 Å

PDB Description: crystal structure of the extracellular region of rat her2
PDB Compounds: (C:) protooncoprotein

SCOPe Domain Sequences for d1n8yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glgmehlrgaraitsdnvqefdgckkifgslaflpesfdgdpssgiaplrpeqlqvfetl
eeitgylyisawpdslrdlsvfqnlriirgrilhdgaysltlqglgihslglrslrelgs
glalihrnahlcfvhtvpwdqlfrnphqallhsgnrpeedcglegl

SCOPe Domain Coordinates for d1n8yc2:

Click to download the PDB-style file with coordinates for d1n8yc2.
(The format of our PDB-style files is described here.)

Timeline for d1n8yc2: