Lineage for d1n6ua1 (1n6u A:1-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767817Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)
  7. 1767818Species Human (Homo sapiens) [TaxId:9606] [89200] (4 PDB entries)
  8. 1767825Domain d1n6ua1: 1n6u A:1-109 [85363]

Details for d1n6ua1

PDB Entry: 1n6u (more details)

PDB Description: nmr structure of the interferon-binding ectodomain of the human interferon receptor
PDB Compounds: (A:) Interferon-alpha/beta receptor beta chain

SCOPe Domain Sequences for d1n6ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ua1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

SCOPe Domain Coordinates for d1n6ua1:

Click to download the PDB-style file with coordinates for d1n6ua1.
(The format of our PDB-style files is described here.)

Timeline for d1n6ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n6ua2