SCOP 1.65: Domain d1n6ua1: 1n6u A:1-109

Lineage for d1n6ua1 (1n6u A:1-109)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Interferon-alpha/beta receptor beta chain [89199] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89200] (2 PDB entries)

8. Domain d1n6ua1: 1n6u A:1-109 [85363]

Details for d1n6ua1

PDB Entry: 1n6u

PDB Description: nmr structure of the interferon-binding ectodomain of the human interferon receptor

SCOP Domain Sequences for d1n6ua1:

Sequence; same for both SEQRES and ATOM records:

>d1n6ua1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens)}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep

Timeline for d1n6ua1:

• d1n6ua1 is new in SCOP 1.65
  
• d1n6ua1 appears in SCOP 1.67
  
• d1n6ua1 appears in the current release, SCOPe 2.08