Lineage for d1n4ma1 (1n4m A:380-581)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this fold
Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
contains an additional C-terminal helixSpecies Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries) 
Domain d1n4ma1: 1n4m A:380-581 [79994]
bound to the transactivation domain (peptide) of E2F-2
Details for d1n4ma1
PDB Entry: 1n4m (more details), 2.2 Å
PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
PDB Compounds: (A:) Retinoblastoma PocketSCOPe Domain Sequences for d1n4ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4ma1 a.74.1.3 (A:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
slawlsdsplfdlikqsktreg
SCOPe Domain Coordinates for d1n4ma1:
Click to download the PDB-style file with coordinates for d1n4ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n4ma1:
- d1n4ma1 first appeared in SCOP 1.63
- d1n4ma1 appears in SCOPe 2.06
- d1n4ma1 appears in the current release, SCOPe 2.08
View in 3D
