Lineage for d1n4ma1 (1n4m A:380-581)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003928Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 2003929Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 2003930Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 2003937Domain d1n4ma1: 1n4m A:380-581 [79994]
    bound to the transactivation domain (peptide) of E2F-2

Details for d1n4ma1

PDB Entry: 1n4m (more details), 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
PDB Compounds: (A:) Retinoblastoma Pocket

SCOPe Domain Sequences for d1n4ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ma1 a.74.1.3 (A:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
slawlsdsplfdlikqsktreg

SCOPe Domain Coordinates for d1n4ma1:

Click to download the PDB-style file with coordinates for d1n4ma1.
(The format of our PDB-style files is described here.)

Timeline for d1n4ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ma2