Lineage for d1mzya2 (1mzy A:194-371)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding siteFamily b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) 
Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [419333] (8 PDB entries)
Uniprot Q53239
Domain d1mzya2: 1mzy A:194-371 [103849]
Other proteins in same PDB: d1mzya1
complexed with cu, mg
has additional insertions and/or extensions that are not grouped together
Details for d1mzya2
PDB Entry: 1mzy (more details), 1.46 Å
PDB Description: crystal structure of nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductaseSCOPe Domain Sequences for d1mzya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR, C-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn
gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw
firggtagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg
SCOPe Domain Coordinates for d1mzya2:
Click to download the PDB-style file with coordinates for d1mzya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mzya2:
- d1mzya2 first appeared in SCOP 1.69
- d1mzya2 appears in SCOPe 2.07
View in 3D
