SCOPe 2.08: Domain d1mzya1: 1mzy A:41-193

Lineage for d1mzya1 (1mzy A:41-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [419332] (8 PDB entries)
   Uniprot Q53239

8. Domain d1mzya1: 1mzy A:41-193 [103848]
   Other proteins in same PDB: d1mzya2
   complexed with cu, mg

Details for d1mzya1

PDB Entry: 1mzy, 1.46 Å

PDB Description: crystal structure of nitrite reductase

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1mzya1:

Sequence; same for both SEQRES and ATOM records:

>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR, N-terminal domain {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgmagcimvlprdg

Timeline for d1mzya1:

• d1mzya1 first appeared in SCOP 1.69
  
• d1mzya1 appears in SCOPe 2.07