Lineage for d1myna_ (1myn A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889275Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 889477Family g.3.7.4: Insect defensins [57163] (5 proteins)
  6. 889491Protein Drosomycin [57164] (1 species)
    inducible antifungal protein
  7. 889492Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [57165] (1 PDB entry)
  8. 889493Domain d1myna_: 1myn A: [44172]

Details for d1myna_

PDB Entry: 1myn (more details)

PDB Description: solution structure of drosomycin, the first inducible antifungal protein from insects, nmr, 15 structures
PDB Compounds: (A:) drosomycin

SCOP Domain Sequences for d1myna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1myna_ g.3.7.4 (A:) Drosomycin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dclsgrykgpcavwdnetcrrvckeegrssghcspslkcwcegc

SCOP Domain Coordinates for d1myna_:

Click to download the PDB-style file with coordinates for d1myna_.
(The format of our PDB-style files is described here.)

Timeline for d1myna_: