Lineage for d1mrzb2 (1mrz B:302-458)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) 
Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species) Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
Uniprot Q9WZW1
TM0379
Domain d1mrzb2: 1mrz B:302-458 [91455]
Other proteins in same PDB: d1mrza1, d1mrzb1
complexed with cit
Details for d1mrzb2
PDB Entry: 1mrz (more details), 1.9 Å
PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferaseSCOPe Domain Sequences for d1mrzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrzb2 c.26.1.3 (B:302-458) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
vyeiedvvvqgkrvssslirnlvqegrveeipaylgr
SCOPe Domain Coordinates for d1mrzb2:
Click to download the PDB-style file with coordinates for d1mrzb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mrzb2:
- d1mrzb2 first appeared in SCOP 1.67
- d1mrzb2 appears in SCOPe 2.06
- d1mrzb2 appears in the current release, SCOPe 2.08
View in 3D
