SCOPe 2.07: Domain d1mrzb1: 1mrz B:459-589

Lineage for d1mrzb1 (1mrz B:459-589)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families)

5. Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
   automatically mapped to Pfam PF01687

6. Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
   Uniprot Q9WZW1
   TM0379

8. Domain d1mrzb1: 1mrz B:459-589 [91454]
   Other proteins in same PDB: d1mrza2, d1mrzb2
   complexed with cit

Details for d1mrzb1

PDB Entry: 1mrz, 1.9 Å

PDB Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379

PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1mrzb1:

Sequence, based on SEQRES records:

>d1mrzb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records):

>d1mrzb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyild
fegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

Timeline for d1mrzb1:

• d1mrzb1 first appeared in SCOP 1.67
  
• d1mrzb1 appears in SCOPe 2.06
  
• d1mrzb1 appears in the current release, SCOPe 2.08