Lineage for d1mlda2 (1mld A:145-313)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938965Protein Malate dehydrogenase [56329] (12 species)
  7. 1939026Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 1939027Domain d1mlda2: 1mld A:145-313 [42089]
    Other proteins in same PDB: d1mlda1, d1mldb1, d1mldc1, d1mldd1
    complexed with cit

Details for d1mlda2

PDB Entry: 1mld (more details), 1.83 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1mlda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
vttldivranafvaelkgldparvsvpvigghagktiiplisqctpkvdfpqdqlstltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetdcpyf
stplllgkkgieknlgigkispfeekmiaeaipelkasikkgeefvknm

SCOPe Domain Coordinates for d1mlda2:

Click to download the PDB-style file with coordinates for d1mlda2.
(The format of our PDB-style files is described here.)

Timeline for d1mlda2: