Lineage for d1mlda2 (1mld A:145-313)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36979Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 36980Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 36981Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)
  6. 37025Protein Malate dehydrogenase [56329] (7 species)
  7. 37042Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 37043Domain d1mlda2: 1mld A:145-313 [42089]
    Other proteins in same PDB: d1mlda1, d1mldb1, d1mldc1, d1mldd1

Details for d1mlda2

PDB Entry: 1mld (more details), 1.9 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases

SCOP Domain Sequences for d1mlda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa)}
vttldivranafvaelkgldparvsvpvigghagktiiplisqctpkvdfpqdqlstltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetdcpyf
stplllgkkgieknlgigkispfeekmiaeaipelkasikkgeefvknm

SCOP Domain Coordinates for d1mlda2:

Click to download the PDB-style file with coordinates for d1mlda2.
(The format of our PDB-style files is described here.)

Timeline for d1mlda2: