Lineage for d1mkaa_ (1mka A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550748Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2550749Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 2550750Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 2550751Domain d1mkaa_: 1mka A: [38543]
    CASP1
    complexed with dac

Details for d1mkaa_

PDB Entry: 1mka (more details), 2 Å

PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine
PDB Compounds: (A:) beta-hydroxydecanoyl thiol ester dehydrase

SCOPe Domain Sequences for d1mkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

SCOPe Domain Coordinates for d1mkaa_:

Click to download the PDB-style file with coordinates for d1mkaa_.
(The format of our PDB-style files is described here.)

Timeline for d1mkaa_: