SCOPe 2.08: Domain d1mkaa_: 1mka A:

Lineage for d1mkaa_ (1mka A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
   contains two additional beta-strands in the N-terminal extension

6. Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)

7. Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)

8. Domain d1mkaa_: 1mka A: [38543]
   CASP1
   complexed with dac

Details for d1mkaa_

PDB Entry: 1mka, 2 Å

PDB Description: e. coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-n-acetyl cysteamine

PDB Compounds: (A:) beta-hydroxydecanoyl thiol ester dehydrase

SCOPe Domain Sequences for d1mkaa_:

Sequence; same for both SEQRES and ATOM records:

>d1mkaa_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqdtsaf

Timeline for d1mkaa_:

• d1mkaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1mkaa_ appears in SCOPe 2.07