Lineage for d1mb8a2 (1mb8 A:181-293)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998100Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1998101Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1998102Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 1998103Protein Actin binding domain of plectin [89056] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 1998104Species Human (Homo sapiens) [TaxId:9606] [89057] (3 PDB entries)
    Uniprot Q9QXS1 182-411
  8. 1998112Domain d1mb8a2: 1mb8 A:181-293 [84926]
    Other proteins in same PDB: d1mb8a3

Details for d1mb8a2

PDB Entry: 1mb8 (more details), 2.15 Å

PDB Description: Crystal Structure of the actin binding domain of plectin
PDB Compounds: (A:) Plectin

SCOPe Domain Sequences for d1mb8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mb8a2 a.40.1.1 (A:181-293) Actin binding domain of plectin {Human (Homo sapiens) [TaxId: 9606]}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp

SCOPe Domain Coordinates for d1mb8a2:

Click to download the PDB-style file with coordinates for d1mb8a2.
(The format of our PDB-style files is described here.)

Timeline for d1mb8a2: