Class a: All alpha proteins [46456] (179 folds) |
Fold a.40: CH domain-like [47575] (2 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) |
Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (6 proteins) |
Protein Actin binding domain of plectin [89056] (1 species) duplication: consists of tandem repeat of two CH domains |
Species Human (Homo sapiens) [TaxId:9606] [89057] (1 PDB entry) |
Domain d1mb8a2: 1mb8 A:181-293 [84926] |
PDB Entry: 1mb8 (more details), 2.15 Å
SCOP Domain Sequences for d1mb8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mb8a2 a.40.1.1 (A:181-293) Actin binding domain of plectin {Human (Homo sapiens)} qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamprvp
Timeline for d1mb8a2: