Lineage for d1m9sa5 (1m9s A:36-240)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111496Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2111565Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2111566Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 2111580Protein Internalin B [52060] (1 species)
  7. 2111581Species Listeria monocytogenes [TaxId:1639] [52061] (6 PDB entries)
  8. 2111587Domain d1m9sa5: 1m9s A:36-240 [78878]
    Other proteins in same PDB: d1m9sa1, d1m9sa2, d1m9sa3, d1m9sa4
    complexed with so4, tb

Details for d1m9sa5

PDB Entry: 1m9s (more details), 2.65 Å

PDB Description: Crystal structure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains.
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d1m9sa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9sa5 c.10.2.1 (A:36-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}
etitvstpikqifpddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq
ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis
dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl
sknhisdlralaglknldvlelfsq

SCOPe Domain Coordinates for d1m9sa5:

Click to download the PDB-style file with coordinates for d1m9sa5.
(The format of our PDB-style files is described here.)

Timeline for d1m9sa5: