Lineage for d1m32b_ (1m32 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503335Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2503336Protein 2-aminoethylphosphonate transaminase [82486] (1 species)
  7. 2503337Species Salmonella typhimurium [TaxId:90371] [82487] (1 PDB entry)
  8. 2503339Domain d1m32b_: 1m32 B: [78509]
    complexed with plp, po4, poa

Details for d1m32b_

PDB Entry: 1m32 (more details), 2.2 Å

PDB Description: crystal structure of 2-aminoethylphosphonate transaminase
PDB Compounds: (B:) 2-aminoethylphosphonate-pyruvate aminotransferase

SCOPe Domain Sequences for d1m32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m32b_ c.67.1.3 (B:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]}
nyllltpgplttsrtvkeamlfdsctwdddynigvveqirqqltalatasegytsvllqg
sgsyaveavlgsalgpqdkvlivsngaygarmvemaglmgiahhaydcgevarpdvqaid
ailnadptishiamvhsetttgmlnpidevgalahrygktyivdamssfggipmdiaalh
idylissankciqgvpgfafviareqklaackghsrslsldlyaqwrcmednhgkwrfts
pthtvlafaqalkelakeggvaarhqryqqnqrslvagmralgfntllddelhspiitaf
yspedpqyrfsefyrrlkeqgfviypgkvsqsdcfrignigevyaaditalltairtamy
wt

SCOPe Domain Coordinates for d1m32b_:

Click to download the PDB-style file with coordinates for d1m32b_.
(The format of our PDB-style files is described here.)

Timeline for d1m32b_: