Lineage for d1lsla1 (1lsl A:416-469)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038349Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily)
    disulfide-rich fold; all-beta: 3 antiparallel strands
  4. 3038350Superfamily g.60.1: TSP-1 type 1 repeat [82895] (2 families) (S)
    automatically mapped to Pfam PF00090
  5. 3038351Family g.60.1.1: TSP-1 type 1 repeat [82896] (2 proteins)
  6. 3038352Protein Thrombospondin-1 (TSP-1) [82897] (1 species)
  7. 3038353Species Human (Homo sapiens) [TaxId:9606] [82898] (1 PDB entry)
  8. 3038354Domain d1lsla1: 1lsl A:416-469 [78178]
    repeats 2 and 3 (res. 434-546)
    complexed with fuc, ful

Details for d1lsla1

PDB Entry: 1lsl (more details), 1.9 Å

PDB Description: crystal structure of the thrombospondin-1 type 1 repeats
PDB Compounds: (A:) Thrombospondin 1

SCOPe Domain Sequences for d1lsla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsla1 g.60.1.1 (A:416-469) Thrombospondin-1 (TSP-1) {Human (Homo sapiens) [TaxId: 9606]}
qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkd

SCOPe Domain Coordinates for d1lsla1:

Click to download the PDB-style file with coordinates for d1lsla1.
(The format of our PDB-style files is described here.)

Timeline for d1lsla1:

3038354
d1lsla1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lsla2