Lineage for d1lsla1 (1lsl A:416-469)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271822Fold g.60: TSP-1 type 1 repeat [82894] (1 superfamily)
    disulphide-rich fold; all-beta: 3 antiparallel strands
  4. 271823Superfamily g.60.1: TSP-1 type 1 repeat [82895] (1 family) (S)
  5. 271824Family g.60.1.1: TSP-1 type 1 repeat [82896] (1 protein)
  6. 271825Protein Thrombospondin-1 (TSP-1) [82897] (1 species)
  7. 271826Species Human (Homo sapiens) [TaxId:9606] [82898] (1 PDB entry)
  8. 271827Domain d1lsla1: 1lsl A:416-469 [78178]

Details for d1lsla1

PDB Entry: 1lsl (more details), 1.9 Å

PDB Description: crystal structure of the thrombospondin-1 type 1 repeats

SCOP Domain Sequences for d1lsla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lsla1 g.60.1.1 (A:416-469) Thrombospondin-1 (TSP-1) {Human (Homo sapiens)}
qdggwshwspwsscsvtcgdgvitrirlcnspspqmngkpcegearetkackkd

SCOP Domain Coordinates for d1lsla1:

Click to download the PDB-style file with coordinates for d1lsla1.
(The format of our PDB-style files is described here.)

Timeline for d1lsla1:

271827
d1lsla1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1lsla2