Lineage for d1lqaa_ (1lqa A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568313Protein Tas protein [89461] (1 species)
  7. 1568314Species Escherichia coli [TaxId:562] [89462] (1 PDB entry)
  8. 1568315Domain d1lqaa_: 1lqa A: [84674]
    structural genomics
    complexed with ndp

Details for d1lqaa_

PDB Entry: 1lqa (more details), 1.6 Å

PDB Description: tas protein from escherichia coli in complex with nadph
PDB Compounds: (A:) Tas protein

SCOPe Domain Sequences for d1lqaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]}
mqyhriphsslevstlglgtmtfgeqnseadahaqldyavaqginlidvaemypvpprpe
tqgltetyvgnwlakhgsrekliiaskvsgpsrnndkgirpdqaldrknirealhdslkr
lqtdyldlyqvhwpqrptncfgklgyswtdsapavslldtldalaeyqragkiryigvsn
etafgvmrylhladkhdlprivtiqnpysllnrsfevglaevsqyegvellaysclgfgt
ltgkylngakpagarntlfsrftrysgeqtqkavaayvdiarrhgldpaqmalafvrrqp
fvastllgattmdqlktnieslhlelsedvlaeieavhqvytypap

SCOPe Domain Coordinates for d1lqaa_:

Click to download the PDB-style file with coordinates for d1lqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1lqaa_: