Lineage for d1lqaa_ (1lqa A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (10 proteins)
Common fold covers whole protein structure
Protein Tas protein [89461] (1 species) Species Escherichia coli [TaxId:562] [89462] (1 PDB entry) 
Domain d1lqaa_: 1lqa A: [84674]
Details for d1lqaa_
PDB Entry: 1lqa (more details), 1.6 Å
PDB Description: tas protein from escherichia coli in complex with nadph
SCOP Domain Sequences for d1lqaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli}
mqyhriphsslevstlglgtmtfgeqnseadahaqldyavaqginlidvaemypvpprpe
tqgltetyvgnwlakhgsrekliiaskvsgpsrnndkgirpdqaldrknirealhdslkr
lqtdyldlyqvhwpqrptncfgklgyswtdsapavslldtldalaeyqragkiryigvsn
etafgvmrylhladkhdlprivtiqnpysllnrsfevglaevsqyegvellaysclgfgt
ltgkylngakpagarntlfsrftrysgeqtqkavaayvdiarrhgldpaqmalafvrrqp
fvastllgattmdqlktnieslhlelsedvlaeieavhqvytypap
SCOP Domain Coordinates for d1lqaa_:
Click to download the PDB-style file with coordinates for d1lqaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lqaa_:
- d1lqaa_ is new in SCOP 1.65
- d1lqaa_ appears in SCOP 1.67
- d1lqaa_ appears in the current release, SCOPe 2.08
View in 3D
