Lineage for d1lkyb_ (1lky B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1090418Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1090419Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 1090429Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 1090439Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)
  8. 1090444Domain d1lkyb_: 1lky B: [73986]
    complexed with so4

Details for d1lkyb_

PDB Entry: 1lky (more details), 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer
PDB Compounds: (B:) transcription factor etv6

SCOPe Domain Sequences for d1lkyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkyb_ a.60.1.1 (B:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
phsgdvlyellqhilkq

SCOPe Domain Coordinates for d1lkyb_:

Click to download the PDB-style file with coordinates for d1lkyb_.
(The format of our PDB-style files is described here.)

Timeline for d1lkyb_: