PDB entry 1lky

View 1lky on RCSB PDB site
Description: Structure of the wild-type TEL-SAM polymer
Class: transcription
Keywords: leukemia, tyrosine kinase, transcriptional repression, drug design
Deposited on 2002-04-26, released 2002-06-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (65)
    Domains in SCOPe 2.02: d1lkya_
  • Chain 'B':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (46)
    Domains in SCOPe 2.02: d1lkyb_
  • Chain 'C':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (65)
    Domains in SCOPe 2.02: d1lkyc_
  • Chain 'D':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (46)
    Domains in SCOPe 2.02: d1lkyd_
  • Chain 'E':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (65)
    Domains in SCOPe 2.02: d1lkye_
  • Chain 'F':
    Compound: transcription factor etv6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41212 (0-76)
      • engineered (46)
    Domains in SCOPe 2.02: d1lkyf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyA (A:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdrlyellqhilkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyB (B:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
    phsgdvlyellqhilkq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyC (C:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdrlyellqhilkq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyD (D:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
    phsgdvlyellqhilkq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyE (E:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
    phsgdrlyellqhilkq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lkyF (F:)
    sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
    phsgdvlyellqhilkq