Lineage for d1kjya2 (1kjy A:30-60,A:182-349)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595281Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1595330Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 1595348Domain d1kjya2: 1kjy A:30-60,A:182-349 [72625]
    Other proteins in same PDB: d1kjya1, d1kjyc1
    bound to the goloco motif of rgs14, chains B and D
    complexed with cs, gdp, mg

Details for d1kjya2

PDB Entry: 1kjy (more details), 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1kjya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjya2 c.37.1.8 (A:30-60,A:182-349) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
garevkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserk
kwihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilfln
kkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdt
knvqfvfdavtdviiknnlk

SCOPe Domain Coordinates for d1kjya2:

Click to download the PDB-style file with coordinates for d1kjya2.
(The format of our PDB-style files is described here.)

Timeline for d1kjya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjya1