Lineage for d1ki0a2 (1ki0 A:164-250)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033346Domain d1ki0a2: 1ki0 A:164-250 [72494]
    Angiostatin: the N-terminal fragment containing three kringles
    complexed with bcn

Details for d1ki0a2

PDB Entry: 1ki0 (more details), 1.75 Å

PDB Description: the x-ray structure of human angiostatin
PDB Compounds: (A:) angiostatin

SCOPe Domain Sequences for d1ki0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ki0a2 g.14.1.1 (A:164-250) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
eecmhcsgenydgkisktmsglecqawdsqsphahgyipskfpnknlkknycrnpdrelr
pwcfttdpnkrwelcdiprcttpppss

SCOPe Domain Coordinates for d1ki0a2:

Click to download the PDB-style file with coordinates for d1ki0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ki0a2: