PDB entry 1ki0

View 1ki0 on RCSB PDB site
Description: The X-ray Structure of Human Angiostatin
Class: hydrolase
Keywords: kringle domains, HYDROLASE
Deposited on 2001-12-02, released 2002-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.196
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiostatin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-252)
      • engineered (208)
    Domains in SCOPe 2.08: d1ki0a1, d1ki0a2, d1ki0a3
  • Heterogens: BCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ki0A (A:)
    lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
    qgpwcyttdpekrydycdileceeecmhcsgenydgkisktmsglecqawdsqsphahgy
    ipskfpnknlkknycrnpdrelrpwcfttdpnkrwelcdiprcttpppssgptyqclkgt
    genyrgnvavtvsghtcqhwsaqtphthertpenfpcknldenycrnpdgkrapwchttn
    sqvrweyckipsc