Lineage for d1kf6c_ (1kf6 C:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237813Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1237874Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1237892Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (5 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 1237893Protein Fumarate reductase subunit FrdC [81370] (1 species)
  7. 1237894Species Escherichia coli [TaxId:562] [81369] (5 PDB entries)
    is not known to bind heme
  8. 1237895Domain d1kf6c_: 1kf6 C: [72399]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6a3, d1kf6b1, d1kf6b2, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6m3, d1kf6n1, d1kf6n2, d1kf6p_
    complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6c_

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (C:) fumarate reductase 15 kda hydrophobic protein

SCOPe Domain Sequences for d1kf6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]}
ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOPe Domain Coordinates for d1kf6c_:

Click to download the PDB-style file with coordinates for d1kf6c_.
(The format of our PDB-style files is described here.)

Timeline for d1kf6c_: