Lineage for d1kf6a3 (1kf6 A:226-357)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226244Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 1226245Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 1226246Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 1226285Protein Fumarate reductase [56429] (2 species)
  7. 1226286Species Escherichia coli [TaxId:562] [56430] (5 PDB entries)
  8. 1226287Domain d1kf6a3: 1kf6 A:226-357 [72396]
    Other proteins in same PDB: d1kf6a1, d1kf6a2, d1kf6b1, d1kf6b2, d1kf6c_, d1kf6d_, d1kf6m1, d1kf6m2, d1kf6n1, d1kf6n2, d1kf6o_, d1kf6p_
    complexed with 1pe, act, ce1, f3s, fad, fes, hqo, k, oaa, sf4

Details for d1kf6a3

PDB Entry: 1kf6 (more details), 2.7 Å

PDB Description: E. coli Quinol-Fumarate Reductase with Bound Inhibitor HQNO
PDB Compounds: (A:) fumarate reductase flavoprotein

SCOPe Domain Sequences for d1kf6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOPe Domain Coordinates for d1kf6a3:

Click to download the PDB-style file with coordinates for d1kf6a3.
(The format of our PDB-style files is described here.)

Timeline for d1kf6a3: