SCOPe 2.01: Domain d1k8kd2: 1k8k D:121-284

Lineage for d1k8kd2 (1k8k D:121-284)

Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)
Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
Protein ARPC2 (34 kDa subunit) [69649] (1 species)
duplication: tandem repeat of two domains of this fold
Species Cow (Bos taurus) [TaxId:9913] [69650] (10 PDB entries)
Uniprot O15144 1-282 # 100% sequence identity
Domain d1k8kd2: 1k8k D:121-284 [68310]
Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8kd2

PDB Description: Crystal Structure of Arp2/3 Complex

PDB Compounds: (D:) arp2/3 complex 34 kda subunit

SCOPe Domain Sequences for d1k8kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kd2 d.198.2.1 (D:121-284) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpda

SCOPe Domain Coordinates for d1k8kd2:

Click to download the PDB-style file with coordinates for d1k8kd2.
(The format of our PDB-style files is described here.)

Timeline for d1k8kd2: