Lineage for d1k8kf_ (1k8k F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050398Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1050472Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1050473Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1050496Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1050497Species Cow (Bos taurus) [TaxId:9913] [69648] (13 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1050498Domain d1k8kf_: 1k8k F: [68312]
    Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kg_

Details for d1k8kf_

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (F:) arp2/3 complex 20 kda subunit

SCOPe Domain Sequences for d1k8kf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k8kf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d1k8kf_:

Click to download the PDB-style file with coordinates for d1k8kf_.
(The format of our PDB-style files is described here.)

Timeline for d1k8kf_: