Lineage for d1jxsa_ (1jxs A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693317Protein Interleukin enhancer binding factor [88984] (1 species)
  7. 2693318Species Human (Homo sapiens) [TaxId:9606] [88985] (1 PDB entry)
  8. 2693319Domain d1jxsa_: 1jxs A: [84254]

Details for d1jxsa_

PDB Entry: 1jxs (more details)

PDB Description: solution structure of the dna-binding domain of interleukin enhancer binding factor
PDB Compounds: (A:) interleukin enhancer binding factor

SCOPe Domain Sequences for d1jxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxsa_ a.4.5.14 (A:) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]}
dskppysyaqlivqaitmapdkqltlngiythitknypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpasesklieqafrkrrpr

SCOPe Domain Coordinates for d1jxsa_:

Click to download the PDB-style file with coordinates for d1jxsa_.
(The format of our PDB-style files is described here.)

Timeline for d1jxsa_: