Lineage for d1jxka1 (1jxk A:404-491)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-keySuperfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) 
this domain is C-terminal to the catalytic beta/alpha barrel domainFamily b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
this domain follows the catalytic beta/alpha barrel domain
Protein Animal alpha-amylase [51024] (3 species) Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
Uniprot P04746 16-511 ! SQ 04746
Domain d1jxka1: 1jxk A:404-491 [63316]
Other proteins in same PDB: d1jxka2
complexed with ca, cl
Details for d1jxka1
PDB Entry: 1jxk (more details), 1.9 Å
PDB Description: role of ethe mobile loop in the mehanism of human salivary amylase
PDB Compounds: (A:) Alpha-amylase, salivarySCOPe Domain Sequences for d1jxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxka1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl
SCOPe Domain Coordinates for d1jxka1:
Click to download the PDB-style file with coordinates for d1jxka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jxka1:
- d1jxka1 first appeared in SCOP 1.57
- d1jxka1 appears in SCOPe 2.06
- d1jxka1 appears in the current release, SCOPe 2.08
View in 3D
