Lineage for d1jxka1 (1jxk A:404-491)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63005Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 63006Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 63007Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)
  6. 63008Protein Animal alpha-amylase [51024] (3 species)
  7. 63009Species Human (Homo sapiens) [TaxId:9606] [51026] (10 PDB entries)
  8. 63012Domain d1jxka1: 1jxk A:404-491 [63316]
    Other proteins in same PDB: d1jxka2

Details for d1jxka1

PDB Entry: 1jxk (more details), 1.9 Å

PDB Description: role of ethe mobile loop in the mehanism of human salivary amylase

SCOP Domain Sequences for d1jxka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxka1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens)}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1jxka1:

Click to download the PDB-style file with coordinates for d1jxka1.
(The format of our PDB-style files is described here.)

Timeline for d1jxka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxka2