Lineage for d1jxka1 (1jxk A:404-491)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins) Protein Animal alpha-amylase [51024] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [51026] (10 PDB entries) 
Domain d1jxka1: 1jxk A:404-491 [63316]
Other proteins in same PDB: d1jxka2
Details for d1jxka1
PDB Entry: 1jxk (more details), 1.9 Å
PDB Description: role of ethe mobile loop in the mehanism of human salivary amylase
SCOP Domain Sequences for d1jxka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxka1 b.71.1.1 (A:404-491) Animal alpha-amylase {Human (Homo sapiens)}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl
SCOP Domain Coordinates for d1jxka1:
Click to download the PDB-style file with coordinates for d1jxka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jxka1:
- d1jxka1 is new in SCOP 1.57
- d1jxka1 appears in SCOP 1.59
- d1jxka1 appears in the current release, SCOPe 2.08
View in 3D
