Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species) |
Species Escherichia coli [TaxId:562] [56238] (7 PDB entries) Uniprot P17169 1-238 |
Domain d1jxaa2: 1jxa A:1-240 [67408] Other proteins in same PDB: d1jxaa1, d1jxab1, d1jxac1 complexed with g6q |
PDB Entry: 1jxa (more details), 3.1 Å
SCOPe Domain Sequences for d1jxaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jxaa2 d.153.1.1 (A:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]} cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
Timeline for d1jxaa2:
View in 3D Domains from other chains: (mouse over for more information) d1jxab1, d1jxab2, d1jxac1, d1jxac2 |