Lineage for d1jxaa1 (1jxa A:241-608)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140245Family c.80.1.1: double-SIS domain [53698] (5 protein domains)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2140246Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 2140247Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)
  8. 2140257Domain d1jxaa1: 1jxa A:241-608 [67407]
    Other proteins in same PDB: d1jxaa2, d1jxab2, d1jxac2
    complexed with g6q

Details for d1jxaa1

PDB Entry: 1jxa (more details), 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate
PDB Compounds: (A:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1jxaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxaa1 c.80.1.1 (A:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOPe Domain Coordinates for d1jxaa1:

Click to download the PDB-style file with coordinates for d1jxaa1.
(The format of our PDB-style files is described here.)

Timeline for d1jxaa1: