Lineage for d1jw1a1 (1jw1 A:1-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2914985Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2914986Protein Lactoferrin [53889] (6 species)
  7. 2915023Species Goat (Capra hircus) [TaxId:9925] [89791] (1 PDB entry)
  8. 2915024Domain d1jw1a1: 1jw1 A:1-333 [84234]
    complexed with fe

Details for d1jw1a1

PDB Entry: 1jw1 (more details), 4 Å

PDB Description: Crystallization and structure determination of goat lactoferrin at 4.0 resolution: A new form of packing in lactoferrins with a high solvent content in crystals
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1jw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jw1a1 c.94.1.2 (A:1-333) Lactoferrin {Goat (Capra hircus) [TaxId: 9925]}
aprknvrwcaislpewskcyqwqrrmrklgapsitcvrrtsvleciraiagknadavtld
dgmvfeagrdpyklrpvaaeiygtekspqthyyavavvkkgsnfkldqlqgqkschmglg
rsagwnipvgilrpplswtesaeplqgavarffsascvpcvdgkaypnlcqlckgvgenk
cacssqepyfgysgafkclqdgagdvafvkettvfenlpekadrdqyellclnntrapvd
afkechlaqvpshavvarsvdgkenliwellrkaqekfgknksqrfqlfgspegrrdllf
kdsalgflripskvdsalylgsryltalknlre

SCOPe Domain Coordinates for d1jw1a1:

Click to download the PDB-style file with coordinates for d1jw1a1.
(The format of our PDB-style files is described here.)

Timeline for d1jw1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jw1a2