Lineage for d1jt0a2 (1jt0 A:73-189)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) 
Protein Multidrug binding protein QacR [69107] (1 species) Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
Uniprot P23217
Domain d1jt0a2: 1jt0 A:73-189 [71851]
Other proteins in same PDB: d1jt0a1, d1jt0b1, d1jt0c1, d1jt0d1
protein/DNA complex; complexed with so4
Details for d1jt0a2
PDB Entry: 1jt0 (more details), 2.9 Å
PDB Description: crystal structure of a cooperative qacr-dna complex
PDB Compounds: (A:) hypothetical transcriptional regulator in qaca 5'regionSCOPe Domain Sequences for d1jt0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt0a2 a.121.1.1 (A:73-189) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflnglskh
SCOPe Domain Coordinates for d1jt0a2:
Click to download the PDB-style file with coordinates for d1jt0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jt0a2:
- d1jt0a2 first appeared in SCOP 1.61
- d1jt0a2 appears in SCOP 1.75
- d1jt0a2 appears in SCOPe 2.02
- d1jt0a2 appears in the current release, SCOPe 2.08
View in 3D
