Lineage for d1jt0a2 (1jt0 A:73-189)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 156164Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
  4. 156165Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 156166Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (2 proteins)
  6. 156167Protein Multidrug binding protein QacR [69107] (1 species)
  7. 156168Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)
  8. 156193Domain d1jt0a2: 1jt0 A:73-189 [71851]
    Other proteins in same PDB: d1jt0a1, d1jt0b1, d1jt0c1, d1jt0d1

Details for d1jt0a2

PDB Entry: 1jt0 (more details), 2.9 Å

PDB Description: Crystal structure of a cooperative QacR-DNA complex

SCOP Domain Sequences for d1jt0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt0a2 a.121.1.1 (A:73-189) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflnglskh

SCOP Domain Coordinates for d1jt0a2:

Click to download the PDB-style file with coordinates for d1jt0a2.
(The format of our PDB-style files is described here.)

Timeline for d1jt0a2: