Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Human (Homo sapiens), zeta isoform [TaxId:9606] [68937] (2 PDB entries) |
Domain d1jeba_: 1jeb A: [66591] Other proteins in same PDB: d1jebb_, d1jebd_ complexed with cmo, hem |
PDB Entry: 1jeb (more details), 2.1 Å
SCOPe Domain Sequences for d1jeba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens), zeta isoform [TaxId: 9606]} sltktertiivsmwakistqadtigtetlerlflshpqtktyfphfdlhpgsaqlrahgs kvvaavgdavksiddiggalsklselhayilrvdpvnfkllshcllvtlaarfpadftae ahaawdkflsvvssvltekyr
Timeline for d1jeba_: