Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species) |
Species Escherichia coli [TaxId:562] [51386] (2 PDB entries) merged in bifunctional enzyme with PRA isomerase |
Domain d1jcmp_: 1jcm P: [71633] stability mutant containing an engineered disulfide bridge complexed with 137, po4; mutant |
PDB Entry: 1jcm (more details), 2.1 Å
SCOPe Domain Sequences for d1jcmp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcmp_ c.1.2.4 (P:) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} mqcvlakivadkaiwvearkqqqplasfqnevqpstrhfydalqgartafileckkasps kgvirddfdpariaaiykhyasaisvltdekyfqgsfnflpivsqiapqpilckdfiidp yqiylaryyqadacllmlsvldddqyrqlaavahslemgvltevsneeeqeraialgakv vginnrdlcdlsidlnrtrelapklghnvtvisesgintyaqvrelshfangfligsalm ahddlhaavrrvllgenkv
Timeline for d1jcmp_: