PDB entry 1jcm

View 1jcm on RCSB PDB site
Description: trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate
Class: lyase
Keywords: beta-alpha-barrel, disulphide bridge, stability mutant, LYASE
Deposited on 2001-06-10, released 2002-06-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.241
AEROSPACI score: -1.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: indole-3-glycerol-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • GB AAB60033 (0-258)
      • engineered (2)
      • engineered (188)
    Domains in SCOPe 2.02: d1jcmp_
  • Heterogens: PO4, 137, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jcmP (P:)
mqcvlakivadkaiwvearkqqqplasfqnevqpstrhfydalqgartafileckkasps
kgvirddfdpariaaiykhyasaisvltdekyfqgsfnflpivsqiapqpilckdfiidp
yqiylaryyqadacllmlsvldddqyrqlaavahslemgvltevsneeeqeraialgakv
vginnrdlcdlsidlnrtrelapklghnvtvisesgintyaqvrelshfangfligsalm
ahddlhaavrrvllgenkv