Lineage for d1iw7e_ (1iw7 E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 926369Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 926370Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 926371Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 926372Protein RNA polymerase omega subunit [63564] (3 species)
  7. 926380Species Thermus thermophilus [TaxId:274] [74729] (4 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 926383Domain d1iw7e_: 1iw7 E: [71476]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7p1, d1iw7p2, d1iw7p3
    complexed with mg, pb

Details for d1iw7e_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution
PDB Compounds: (E:) RNA polymerase omega subunit

SCOPe Domain Sequences for d1iw7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7e_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d1iw7e_:

Click to download the PDB-style file with coordinates for d1iw7e_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7e_: