Lineage for d1iw4a_ (1iw4 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894337Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 894338Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 894339Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)
  6. 894340Protein Ascidian trypsin inhibitor [75678] (1 species)
  7. 894341Species Sea squirt (Halocynthia roretzi) [TaxId:7729] [75679] (1 PDB entry)
  8. 894342Domain d1iw4a_: 1iw4 A: [71469]

Details for d1iw4a_

PDB Entry: 1iw4 (more details)

PDB Description: solution structure of ascidian trypsin inhibitor
PDB Compounds: (A:) trypsin inhibitor

SCOP Domain Sequences for d1iw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw4a_ g.68.1.1 (A:) Ascidian trypsin inhibitor {Sea squirt (Halocynthia roretzi) [TaxId: 7729]}
ahmdctefnplcrcnkmlgdlicavigdakeehrnmcalccehpggfeysngpce

SCOP Domain Coordinates for d1iw4a_:

Click to download the PDB-style file with coordinates for d1iw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1iw4a_: