Lineage for d1itfa_ (1itf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1993080Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1993081Protein Interferon-alpha 2a [47314] (1 species)
  7. 1993082Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)
  8. 1993095Domain d1itfa_: 1itf A: [16899]

Details for d1itfa_

PDB Entry: 1itf (more details)

PDB Description: interferon alpha-2a, nmr, 24 structures
PDB Compounds: (A:) interferon alpha-2a

SCOPe Domain Sequences for d1itfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itfa_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

SCOPe Domain Coordinates for d1itfa_:

Click to download the PDB-style file with coordinates for d1itfa_.
(The format of our PDB-style files is described here.)

Timeline for d1itfa_: