SCOPe 2.08: Domain d1itfa_: 1itf A:

Lineage for d1itfa_ (1itf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2a [47314] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)

8. Domain d1itfa_: 1itf A: [16899]

Details for d1itfa_

PDB Entry: 1itf

PDB Description: interferon alpha-2a, nmr, 24 structures

PDB Compounds: (A:) interferon alpha-2a

SCOPe Domain Sequences for d1itfa_:

Sequence; same for both SEQRES and ATOM records:

>d1itfa_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

Timeline for d1itfa_:

• d1itfa_ first appeared (with stable ids) in SCOP 1.55, called d1itf__
  
• d1itfa_ appears in SCOPe 2.07