Lineage for d1irul_ (1iru L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2993094Species Cow (Bos taurus) [TaxId:9913] [75567] (1 PDB entry)
  8. 2993101Domain d1irul_: 1iru L: [71363]
    Other proteins in same PDB: d1irua_, d1irub_, d1iruc_, d1irud_, d1irue_, d1iruf_, d1irug_, d1iruo_, d1irup_, d1iruq_, d1irur_, d1irus_, d1irut_, d1iruu_
    different sequences
    complexed with mg

Details for d1irul_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution
PDB Compounds: (L:) 20S proteasome

SCOPe Domain Sequences for d1irul_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]}
tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
edgwirvssdnvadlhekysg

SCOPe Domain Coordinates for d1irul_:

Click to download the PDB-style file with coordinates for d1irul_.
(The format of our PDB-style files is described here.)

Timeline for d1irul_: